How to develop attentiveness in a child of 8 years?

Very often, parents of students of lower grades are faced with the need to develop care in their child. After all, successful learning without this will not work. A child of 7-8 years of age is still hard to concentrate on due to age. However, students who already cope with this are much quicker and easier to solve the tasks set by the teacher. Special games and interesting exercises can help in the development of mindfulness.

It is customary to distinguish three types of attention:

1. Involuntary - appears unexpectedly by itself. This is the answer to the bright, catchy, making a lot of noise, causing interest, but quickly disappears as soon as the subject becomes ordinary. This type of attention prevails in children under 7 years of age.
2. Arbitrary attention - the crumb learns to control itself, doing not what is interesting to him at the moment, but what is necessary. He learns to focus on his task. At the beginning of school, voluntary attention begins to develop.
3. Postvoluntary attention appears when the baby is already carried away with the task and he does not need any effort to concentrate on him.

Also, attention is divided into visual, auditory and motor-motor.

For the development of each of these types, you can choose the appropriate games and exercises.

• Choose the right time. Do not distract the baby if he is passionate about something. Better to wait until he finishes his activity.
• Ask the household not to disturb you and the baby during the session.
• Let the child, before the start of the lesson, fulfill the primary needs: drink, go to the toilet, remove the toys.
• Use non-standard ways to captivate the crumbs. It is better if they are accompanied by a large number of positive emotions on your part. Exercises should be interesting, understandable and accessible.
• Start with step-by-step instructions for implementation. Make sure that the child fulfills each item of the task to the end.
• Control your emotions. Classes should be held in a friendly atmosphere. Do not criticize the child, scold, raise his voice. Encourage, praise, smile, speak kind words, provide necessary assistance, if required.
• All mental functions are interrelated. The better the child has developed speech and memory, the easier it will be for him to concentrate on something. Therefore, it is necessary to take care not only about the development of the baby’s attention, but also about its overall intellectual development - to train memoryto develop speech.
• Very important is the regularity and regularity of classes. Occupations "from time to time" you can hardly achieve success.

To increase the concentration of attention.

Offer the child a sheet of paper with the text printed on it. The font should be large. Ask your child to find in the text as much as possible of the same letter (for example, the letter “a”) and cross it out with a pencil. The task is performed on time. A child 7-8 years old in 5 minutes should have time to look through 350-400 characters and should allow no more than 10 errors. The parent must control the crumbs, watching that he performs the search strictly on the lines. Classes need to devote 7-10 minutes every day. Gradually, it can be made more difficult by increasing the number of letters to 5.

The baby is offered a sheet of paper with a set of letters of the Russian alphabet. Among them is necessary to find the words.

IPAODROTPMAMANGSHGSCHLDPSVASHLRPAKETYKPOOOPSRKYTSYLYYYYYYVYGLAZSHYANOVZHSFUTORAKROZHKATMSVSVRODRShVYVCHMYYYYUDMIKOLOKOLOKTSYYIMIMVNLSHVSVVSVVSVVSVVSVVSVVSVVSVVSVYVYYYYY

• Labyrinths of different levels of complexity.

• Graphic dictations - drawings on the cell.

Motor-motor attention and the ability to switch develop the following games.

The task of the lead is to throw the ball to the players, naming the words. If the leader called an edible object, then the player needs to catch the ball, but if the inedible - the ball is repelled.

Players sit next to each other and put their hands on the neighbors' knees on the right and left. You need to clap your hands alternately at a given pace. The first and last players slap the knee twice, and the game continues in the reverse order. The player who missed his clap or stumbled out of the game.

At the beginning of the game, all players agree on any movement that will be taboo, i.e. it cannot be repeated. Next, the leader at a fast pace shows the players various movements that they have to repeat after him. The player who repeated the forbidden movement becomes the leader.

Ask the child to show what you call. Call and show with him. When the kid starts to cope with the task at a fast pace with ease, complicate it. Now you can call one and show another. It should only show what you say.

For auditory care:

It is necessary to take an even number of identical opaque bottles. Fill them in pairs with different contents. For example, two bottles - with sand, two more - with small stones, two more - with rice, the following can be filled with coins, various cereals - peas, beans, semolina, twigs, rustling wrappers from candies. Options you can think of many. Take yourself one bottle with each filler, and the second give the crumbs. Shake one of your bottles; your baby should listen carefully to the sound it makes. Now ask the child among their bottles to find a pair by the sound of yours.

Young children can be offered to find the same gloves.

Ask the baby to skip the rhythm suggested for you. Gradually complicate the task.

Show your child the sound of various items. These can be wooden spoons, rattles, various musical instruments. Now ask him to turn away and guess what sounds like.

Visual attention develops:

Spread out 5 different toys in front of the baby and ask him to remember them. Ask your baby to turn away or close his eyes and hide one of the toys at this time. After the crumb opens his eyes, he must name what toys are missing. Gradually complicate the task by increasing the number of toys to 10. This game can be played in another version. It is necessary not to hide a toy, but to swap their order.

With this game, the child quickly learn to look for similar pictures. The game is the best way to learn some rules, poems and develop attention with the child. But! As soon as the child gets tired, the game should stop and continue after a few hours or the next day.

Cut out various colored shapes from colored cardboard. They must be different in shape, color and size. Now lay out a certain sequence of them in front of the child and ask him to remember. Next, you need to mix all the figures in one pile and ask the crumbs to repeat the sequence that was before him. Start with 5 figures. Gradually complicate the task by increasing their number.

Exercises are suitable for training in which a child needs to perform two actions at the same time. For example, you can ask one hand to draw a circle, and the second - a square. Ask your child to read a book and clap their hands after each paragraph or each sentence with a pencil. Let the child try to simultaneously touch his left ear with his right hand and his nose with his left, and then with his left hand to his right ear and his right to his nose. This task must be performed as quickly as possible.

Nowadays in stores you can find a lot of a wide variety of educational toys for children of all ages. All of them, undoubtedly, will have a positive impact on the development of the mental functions of the crumbs.

To develop the ability to focus on the object are well suited:

For elementary school students this may be a petty lego. Or a metal constructor. You can also purchase electronic constructor for your baby, magnetic, constructors with moving parts or radio control, transformer constructors.

They teach the crumb to concentrate on the movement of the model, to help it overcome various obstacles, to prevent collisions and damage. They teach the crumb to concentrate on the movement of the model, to help it overcome various obstacles, to prevent collisions and damage.

All classes are very easy to spend at home, giving them literally 20 minutes. No special skills or teacher education will be required from adults.

Small video lessons will help parents deal with such a problem in children.